PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_016463
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 200aa    MW: 21716.7 Da    PI: 6.3383
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_016463genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.71.5e-41131121100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+l+rkC +dC++apyfp e+ +kf  vhk+FGasnv+kll+++ +++re+++ssl yeAear+rdPvyG+vg+i+ lq q+e+l++el++++
  DCAR_016463  13 PCAACKFLKRKCLPDCIFAPYFPPEEVQKFISVHKIFGASNVSKLLNEVLPHQREETVSSLSYEAEARLRDPVYGCVGTISILQLQVERLQKELDEAN 110
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  DCAR_016463 111 AE 112
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.88912113IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4013110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAASFKVIKY NSPCAACKFL KRKCLPDCIF APYFPPEEVQ KFISVHKIFG ASNVSKLLNE  60
VLPHQREETV SSLSYEAEAR LRDPVYGCVG TISILQLQVE RLQKELDEAN AELVSYARGH  120
HPDICGSGTP GGLPATGAVP AHPMCNYAQI PRQIIRPVDL INTGEAGACN YYQTPSSFSF  180
PWNIETDVQD QGGGTGQGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1483973e-97FJ148397.1 Daucus carota subsp. sativus clone BAC C055M03 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036350.11e-66Lateral organ boundaries domain family protein
SwissprotQ9FML43e-60LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A061FUD51e-66A0A061FUD5_THECC; Lateral organ boundaries domain family protein
STRINGPOPTR_0015s09370.11e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-61LBD family protein